PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g041480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ZF-HD
Protein Properties Length: 265aa    MW: 29788.5 Da    PI: 9.066
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g041480.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.8e-3179133358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     k+rY+eC+kNhAa+ Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
  Csa01g041480.1  79 KARYRECQKNHAATSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEID 133
                     689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-3765142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-2880132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.9E-3081132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.62882131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.65E-17187261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28191262IPR009057Homeodomain-like
TIGRFAMsTIGR015654.4E-30200257IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEVREKKYEK MEMVRSKPSA LDHHRLPPCA YPQTADKDKP TTKRNGSDPD PDLDTNPISI  60
APAPRSYARP QTTSPPPGKA RYRECQKNHA ATSGGHVVDG CGEFMSSGEE GTAESLLCAA  120
CDCHRSFHRK EIDGLFVVNF NNFGHSQRPL VGRHVSPIMM SFGGGGGGGG PAESSTEDLN  180
KFHQSFSGNG VDQFHQFQPK KRFRTKFNEE QKDKMMEFAE KIGWRMTKQD DDEVNRFCRE  240
INVKRQVFKV WMHNNKQAAK KKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-202012581875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010414224.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-166ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLR0GAP21e-172R0GAP2_9BRAS; Uncharacterized protein
STRINGscaffold_304185.11e-171(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-163homeobox protein 24